- MRPL44 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82284
- This antibody was developed against Recombinant Protein corresponding to amino acids: GLLVEELKKR NVSAPESRLT RQSGGTTALP LYFVGLYCDK KLIAEGPGET VLVAEEEAAR VALRKLYGFT ENRRPWNYSK PKETLRAE
- PBS (pH 7.2) and 40% Glycerol
- MRPL44
- Unconjugated
- Human
- Rabbit
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- mitochondrial ribosomal protein L44
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Endocrinology
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- COXPD16, L44MT, MRP-L44
Sequence
GLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAE
Specifications/Features
Available conjugates: Unconjugated